Yesterday I received an email from Con saying that he’s going to Wales for Easter and one of the places he’ll be visiting is: llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (and apparently due to the Welsh language you can’t even try and pronounce it phonetically as the ll’s make “th” sounds and the rest of the letters don’t really sound like they should either).
In partial disbelief that such a name could even exist, I did some goo-diligence and discovered the following site:
http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/
According to their website, that is the longest domain name currently registered in the world, and the name translates (roughly) to: “The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio’s of the red cave”.
If you thought that name was bad, perhaps you could visit a station in wales called: Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion or for a place a little closer to home, you could visit:
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhen
uaakitanarahu
(which is a town in New Zealand)… but the longest name of a place which can be found in the Guiness Book of Records is a place in Thailand called:
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajat
haniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
Imagine how painful it would be trying to tell a taxi driver where you live at 4am in the morning after a big night out if you lived in one of those places 🙂